PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462926299
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 293aa    MW: 32224.2 Da    PI: 9.1458
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462926299genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3543.1e-17205288895
                -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
         B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                 ++++++  +lp +f++++g+++++ +tl+   +s   W+v++ +  ks++++ ++GWk F+kan++++gD+++F  +   e++l++ 
  462926299 205 QNMGSLHGQSLPLTFCKAIGLQEACMITLKTSISSTIAWQVRV-VPYKSCAHMRQSGWKAFCKANKINVGDVCIFNAV---ETKLWHV 288
                567788999*************999877776668889******.6888899************************954...3445554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508636.823197IPR003340B3 DNA binding domain
SMARTSM010190.59797IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-91599IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.37E-91599IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.207198293IPR003340B3 DNA binding domain
SMARTSM010190.019200293IPR003340B3 DNA binding domain
PfamPF023621.1E-14205291IPR003340B3 DNA binding domain
CDDcd100173.43E-10206278No hitNo description
Gene3DG3DSA:2.40.330.105.8E-15207291IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.49E-14212291IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MASPGKQTRM LVPFSHKSLR IPDELAEDIG AAADHVIFEF GKGKAVRRFE VGWDGDGAFL  60
RRGWPEFVSE CGVGAGWLLL LRHRGGGVLA VKAFDDTCCL RELAAQPPAV EATVISNGAP  120
RRPRFINVLP QDSMGKMQIP AAFFQSYIPK EHLNSHKAVV YGPLGKVGDI EVEMSQSGTF  180
FAVFESNGLQ RGSKHDGIKF QQNEQNMGSL HGQSLPLTFC KAIGLQEACM ITLKTSISST  240
IAWQVRVVPY KSCAHMRQSG WKAFCKANKI NVGDVCIFNA VETKLWHVVI NKH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975298.15e-69PREDICTED: putative B3 domain-containing protein Os04g0347400 isoform X1
TrEMBLA0A0A9S1932e-84A0A0A9S193_ARUDO; Uncharacterized protein
STRINGSi012375m8e-83(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187